PERSPECTA

News from every angle

Results for "Brač"

200 stories found

Mostar Psychiatrist Defends Actions After Incident in Makarska
Worldklix-ba4d ago

Mostar Psychiatrist Defends Actions After Incident in Makarska

Dragan Babić, a neuropsychiatrist from Mostar, issued a statement through his lawyers attempting to justify his actions after incidents in Makarska where he allegedly insulted Bosnian and Herzegovinian citizens on national and religious grounds, claiming they called him an 'old geezer'.

Man Attacked in Supetar Over Pentagram T-Shirt
Politicsindex-hr10d ago

Man Attacked in Supetar Over Pentagram T-Shirt

Police have released new details regarding an attack on an 18-year-old in Supetar, Brač, stating that the assailant was displeased with a pentagram motif on the victim's t-shirt and demanded he remove it.

Security Deteriorates in East Sarajevo Amid Criminal Group Clashes
Worldn1-serbiaklix-ba12d ago2 sources

Security Deteriorates in East Sarajevo Amid Criminal Group Clashes

The security situation in East Sarajevo has deteriorated due to ongoing clashes between rival criminal groups, Elez and Ždrale. Police blame the judiciary for the inability to prevent these confrontations, warning that further incidents are likely.

Landfill fire on Brač island, Croatia, continues to burn
Environmentindex-hr16d ago

Landfill fire on Brač island, Croatia, continues to burn

Firefighters have been battling a fire at a waste disposal site on Brač island, Croatia, since Thursday, with the blaze still not extinguished. One person was injured in a vegetation fire near Dalj, and numerous other interventions were reported across the country.

Five Bosnian Mountaineers Die on Mount Elbrus, Day of Mourning Declared
WorldThe Guardiandr-dkyle-uutiset+29helsingin-sanomatnosaftonbladetvgpublicoaktualne-czdelfi-ltdelo+21 more20d ago32 sources

Five Bosnian Mountaineers Die on Mount Elbrus, Day of Mourning Declared

Five Bosnian mountaineers from Zenica died on Mount Elbrus due to a sudden change in weather, prompting a day of mourning in the Federation of Bosnia and Herzegovina and Brčko District. Survivors described the unexpected severe weather conditions, and efforts are underway to transport the bodies back to Bosnia and Herzegovina after identification.

Ousted Turkish Opposition Leader Ozgur Ozel to Form New Party
PoliticsFTAl Jazeeranos+14aftonbladetDWorfdelfi-ltYahoodnevnik-bgTimes of Indiacyprus-mail+6 more26d ago17 sources

Ousted Turkish Opposition Leader Ozgur Ozel to Form New Party

Ozgur Ozel, the recently deposed leader of Turkey's main opposition party, has announced his intention to resign from his current party and establish a new political party. This move signals a significant shake-up in Turkish opposition politics.

Two Dead in Toronto Salsa Festival Shooting
WorldBBCNYTThe Guardian+41dr-dkFox Newscbcnosruvfazaftonbladetberlingske+33 more1mo ago44 sources

Two Dead in Toronto Salsa Festival Shooting

A shooting at a street salsa festival in Toronto has resulted in two deaths and multiple injuries. Authorities are investigating the incident, which caused panic among attendees.

Trump Delivers Mount Rushmore Speech on 250th US Independence Anniversary
PoliticsBBCbloombergNYT+87le-mondewapoThe GuardianNPRAl JazeeraFox Newsnrknzz+79 more1mo ago90 sources

Trump Delivers Mount Rushmore Speech on 250th US Independence Anniversary

Former President Trump delivered a campaign-style speech at Mount Rushmore, marking America's 250th Independence Day. The event drew criticism for its political nature, while international leaders like King Charles and Vladimir Putin also acknowledged the anniversary.

Israeli Settlers Seize Palestinian Family's Home in West Bank
WorldAl JazeeraDawnklix-ba+3naftemporikinewsbeastDaily Sabah1mo ago6 sources

Israeli Settlers Seize Palestinian Family's Home in West Bank

Israeli settlers have taken over an unfinished home in the West Bank that a Palestinian family was building for their son. This incident is part of intensified settler activities in the region, including targeting water supplies.

Clashes Erupt at Anti-Government Protests in Tirana, Albania
WorldAl Jazeerader-standardorf+16deloThe Independentindex-hrn1-serbia24uraktuality-skdnevnik-bgdanas+8 more1mo ago19 sources

Clashes Erupt at Anti-Government Protests in Tirana, Albania

Violent clashes broke out between police and demonstrators during ongoing anti-government protests in Tirana, Albania, resulting in at least 18 arrests and nine police officers injured. Thousands marched towards the police station demanding the release of those detained and calling for the resignation of Prime Minister Edi Rama.

Venezuela Earthquake: Death Toll Rises, Human-Interest Stories Emerge
Worldla-vanguardiacdm-me1mo ago2 sources

Venezuela Earthquake: Death Toll Rises, Human-Interest Stories Emerge

A powerful earthquake has struck Venezuela, causing widespread devastation and a rising death toll of at least 235, with over 50,000 reported missing. Amidst the destruction, a poignant video of an elderly couple embracing during the tremors has gone viral, highlighting the human impact of the disaster.

Amazon Prime Day 2026 Features Major Discounts on Tech and Beauty
CultureFox Newscnbcel-mundo+13deloforbesnational-postla-vanguardiavarietyhindustan-timeshollywood-reporterrolling-stone+5 more1mo ago16 sources

Amazon Prime Day 2026 Features Major Discounts on Tech and Beauty

Amazon's Prime Day 2026 event is offering significant discounts on a wide range of products, including tech gadgets, beauty items, and home electronics. Shoppers can find deals on popular brands and celebrity-approved products.

US and Iran Sign Interim Peace Agreement, Trump Threatens Retaliation
WorldbloombergNYTle-monde+43wapoThe GuardianNPRFox Newsnrkruvtagesschauberlingske+35 more2mo ago46 sources

US and Iran Sign Interim Peace Agreement, Trump Threatens Retaliation

The United States and Iran have signed an interim peace agreement, with President Trump immediately threatening renewed bombing if Iran violates the terms. The deal, signed at Versailles, has been praised by some European nations and Pakistan, while Israel has expressed concerns.

Three Dead in Boat Collision Off Croatian Coast Near Split
Worldnzzruvberlingske+20irozhlasorftelextvn24aktualne-czdelohvgindex-hr+12 more2mo ago23 sources

Three Dead in Boat Collision Off Croatian Coast Near Split

Three people died and one remains missing after a collision between two boats, a passenger vessel and a sailboat, off the Croatian coast near Split. Croatian Prime Minister Plenković expressed condolences to the families of the victims, who were identified as Czech citizens.

Bill Gates Testifies on Epstein Ties, Calls Meetings 'Grave Error'
WorldBBCbloombergNYT+49The GuardianAl Jazeeradr-dkyle-uutisetnosfazaftonbladetberlingske+41 more2mo ago52 sources

Bill Gates Testifies on Epstein Ties, Calls Meetings 'Grave Error'

Bill Gates testified before Congress, stating that his meetings with Jeffrey Epstein were a 'grave error in judgment' and alleging that Epstein attempted to extort him over an extramarital affair. Gates maintained he never reciprocated Epstein's desire for a personal relationship.

Three Injured in Shooting at Vraca Memorial Park in Sarajevo
Worldklix-ban1-bih2mo ago2 sources

Three Injured in Shooting at Vraca Memorial Park in Sarajevo

Three individuals were injured in a shooting incident at the Vraca Memorial Park in Sarajevo. Police reported that two of the injured were hospitalized at KCUS, while the third sought medical attention at a hospital in East Sarajevo.

EU Summit Reaffirms Western Balkans Membership Prospects Amid Regional Tensions
WorldThe Guardianyle-uutisettagesschau+32aftonbladetDWle-figaroder-standardorfdie-presseaktualne-czdelfi-lt+24 more2mo ago35 sources

EU Summit Reaffirms Western Balkans Membership Prospects Amid Regional Tensions

An EU summit with Western Balkan leaders focused on reaffirming their membership prospects, while also addressing a crisis between Serbia and Montenegro that led to Serbia withdrawing BIA officers from their shared border. Discussions also touched upon potential plans for two neighboring countries to unite and EU support for Armenia.

Serbian President Announces Snap Parliamentary Elections for Autumn
PoliticswapoAl Jazeerader-standard+6digi24The Independentindex-hrn1-serbiadnevnik-bgdanas2mo ago9 sources

Serbian President Announces Snap Parliamentary Elections for Autumn

Serbian President Aleksandar Vučić has announced that snap parliamentary elections will be held in the autumn, a move some analysts suggest is a tactic to buy time. This decision comes amidst discussions about the timing and implications of the upcoming elections.

US Indicts Raúl Castro, Intensifying Pressure on Cuba
WorldReutersBBCbloomberg+33NYTwapoThe GuardianNPRFox NewsfazberlingskeSCMP+25 more2mo ago36 sources

US Indicts Raúl Castro, Intensifying Pressure on Cuba

The United States has intensified its pressure on Cuba, including indicting former leader Raúl Castro on murder charges. This action has led to celebrations for Castro in Cuba and international warnings against potential US military intervention.

Halkidiki Wildfire Under Control After Extensive Damage and Evacuations
Environmentder-standardorfdelo+12aktuality-skdanasiefimeridanaftemporikivijesti-mebalkan-webmkd-mknewsbeast+4 more3d ago15 sources

Halkidiki Wildfire Under Control After Extensive Damage and Evacuations

Firefighters have brought a large wildfire in Siviri, Halkidiki, under control after an overnight battle, with no active fronts remaining. The blaze caused significant damage to homes and cars, leading to the evacuation of 481 people by boat and bus.

Major Fires Break Out in Oslo and Brač
Worldnrkvgjutarnji-list+1dagbladet4d ago4 sources

Major Fires Break Out in Oslo and Brač

Significant fires have been reported in a multi-story building in Oslo, Norway, and on the island of Brač, Croatia. Firefighting efforts are underway in both locations, with four Canadair planes deployed to Brač.

Serbian Government Establishes New Anti-Terrorism Body
Politicsn1-serbiadanas7d ago2 sources

Serbian Government Establishes New Anti-Terrorism Body

The Serbian government has established a new national body for combating terrorism, which will be fully operational soon. However, some commentators are warning about the potential for this body to be used against political opponents.

FIFA Defends President Infantino Against Undermining Efforts
PoliticsBBCThe Guardiannzz+17ruvDWsvenska-dagbladetmorgunbladidpublicodelfi-ltdeloThe Independent+9 more8d ago20 sources

FIFA Defends President Infantino Against Undermining Efforts

FIFA has issued strong statements condemning what it describes as a 'concerted and ongoing effort' to undermine its president, Gianni Infantino. The organization defended Infantino against allegations tied to his time at UEFA and criticized media reports as part of a campaign to weaken him.

Croatian PM Plenković Comments on Most Party
Politicsindex-hr13d ago

Croatian PM Plenković Comments on Most Party

Croatian Prime Minister Andrej Plenković visited Bol on Brač island and made comments regarding the Most party. He recommended cooperation with them, suggesting it would lead to quick enlightenment.

FIFA Rejects Boycott Threats Over World Cup Investor Plan
CultureBBCruvfaz+40abc-australiaberlingskeDWle-figarosvenska-dagbladetFrance 24la-repubblicadie-presse+32 more17d ago43 sources

FIFA Rejects Boycott Threats Over World Cup Investor Plan

FIFA has reiterated its commitment to a private investor plan for the World Cup, despite threats of a boycott from UEFA and CONCACAF. Both confederations have rejected the proposal, with UEFA vowing to boycott if the sell-off proceeds, stating that 'nobody is selling football'.

Wildfires Break Out in Greece and Croatia
World24urnaftemporiki24d ago2 sources

Wildfires Break Out in Greece and Croatia

Wildfires have erupted in forested areas, with one reported in Livadi, Thermi municipality in Greece, and another on the island of Brač in Croatia. Firefighting efforts are underway in both locations.

Israeli Airstrike Kills Family of Six in Gaza City
WorldBBCAl Jazeeradr-dk+10der-standardpublicoindex-hrjutarnji-listdanasnaftemporikivijesti-menewsbeast+2 more27d ago13 sources

Israeli Airstrike Kills Family of Six in Gaza City

An Israeli airstrike in Gaza City reportedly killed a family of six, including four children, according to medics and Palestinian officials. The incident occurred despite an ongoing ceasefire.

German Star Criticizes IOC Officials
Worlddelo1mo ago

German Star Criticizes IOC Officials

A German celebrity has sharply criticized officials at the International Olympic Committee (IOC). The articles detail her strong disapproval of their actions or policies.

Taylor Swift and Travis Kelce's Wedding Details Emerge
CultureThe Guardiancbcfaz+20der-standardrzeczpospolitamorgunbladiddigi24hvgindex-hrn1-serbia24ur+12 more1mo ago23 sources

Taylor Swift and Travis Kelce's Wedding Details Emerge

Details surrounding Taylor Swift and Travis Kelce's recent wedding have been revealed, including guest arrivals, post-wedding travel plans, and the bride's choice of designer for her wedding dress. Invitations for the highly anticipated event have also been disclosed by attendees.

Polish Government Faces Political Conflict Over Secret Patriot Missile Transfer to Ukraine
Worldukrainska-pravdarzeczpospolitaaktualne-cz+5delfi-ltdigi24index-hrhotnewsjutarnji-list1mo ago8 sources

Polish Government Faces Political Conflict Over Secret Patriot Missile Transfer to Ukraine

A political scandal has erupted in Poland after the opposition accused the government of secretly transferring Patriot air defense missiles to Ukraine without informing the parliament or the president. The move has sparked a heated debate within the Polish political establishment.

Two Men Shot in Čakovec, Suspect at Large
World24urklix-ba1mo ago2 sources

Two Men Shot in Čakovec, Suspect at Large

Two younger men were shot in Čakovec, Croatia, with the suspect still at large and believed to have fled to Bosnia and Herzegovina. The incident is suspected to be a violent confrontation within the drug underworld.

Two Injured in Čakovec Shooting, Suspect at Large
Worldindex-hrn1-serbiajutarnji-list1mo ago3 sources

Two Injured in Čakovec Shooting, Suspect at Large

Two individuals sustained serious injuries in a shooting incident in the center of Čakovec, Croatia. Police are actively searching for the perpetrator, who remains at large.

NATO Allies Agree to €140 Billion Military Aid Package for Ukraine
WorldbloombergNYTFT+61wapoThe GuardianAl Jazeeratagesschauukrainska-pravdafazaftonbladetle-figaro+53 more1mo ago64 sources

NATO Allies Agree to €140 Billion Military Aid Package for Ukraine

NATO member states have reportedly agreed on a €140 billion military aid package for Ukraine, to be disbursed over 2026 and 2027. This commitment comes as Poland warns of potential Russian provocations and NATO allies emphasize unity against Russian threats.

Croatian President Milanović Clashes with Journalists
Worldn1-serbiajutarnji-list1mo ago2 sources

Croatian President Milanović Clashes with Journalists

Croatian President Zoran Milanović engaged in heated exchanges with journalists, questioning their intelligence and accusing one of freeloading in a state apartment, while also stating the Croatian army would not participate in the Paris military parade.

US and Iran Electronically Sign Memorandum of Understanding
WorldBBCbloombergNYT+97FTle-mondeThe GuardianNPRAl Jazeeradr-dkFox Newsnrk+89 more2mo ago100 sources

US and Iran Electronically Sign Memorandum of Understanding

The United States and Iran have electronically signed a Memorandum of Understanding (MoU), with White House officials confirming its immediate effect. The agreement reportedly addresses the dilution of enriched uranium in Iran, signaling an end to the conflict.

Bill Gates Testifies on Jeffrey Epstein's Blackmail Attempts
WorldBBCFTFox News+22nzztagesschaufazNHK Worldorfrzeczpospolitatvn24die-presse+14 more2mo ago25 sources

Bill Gates Testifies on Jeffrey Epstein's Blackmail Attempts

Bill Gates testified before a committee, revealing that Jeffrey Epstein attempted to blackmail him over extramarital affairs. Gates described his association with Epstein as a 'grave error' and detailed the financier's efforts to pressure him.

12 Injured in Shooting Near Ohio Festival; Suspects Sought
PoliticsBBCNYTThe Guardian+54Al Jazeeradr-dkFox Newscbccnbchelsingin-sanomatnosruv+46 more2mo ago57 sources

12 Injured in Shooting Near Ohio Festival; Suspects Sought

At least 12 people were injured in a shooting incident near a festival in Ohio, prompting a manhunt for the suspects. The event caused panic among attendees, with some reports indicating multiple shooters.

Eight Habits of the Happiest Married Couples
Healthindex-hr2mo ago

Eight Habits of the Happiest Married Couples

According to a psychotherapist, the happiest married couples cultivate eight specific habits, which are not grand gestures but small decisions that build trust, warmth, and resilience in their relationship.

Large Wildfire Rages on Brač Island, Hampered by Strong Winds
Environmentdelon1-serbia24ur+2danasklix-ba4d ago5 sources

Large Wildfire Rages on Brač Island, Hampered by Strong Winds

A significant wildfire has erupted on the Croatian island of Brač, affecting a large area and proving difficult to control due to strong winds. Over 100 firefighters are battling the blaze, with aerial support and additional personnel being deployed.

Milatović Urges Against Politicizing Montenegrin Army Victories
Politicsdanasvijesti-me9d ago2 sources

Milatović Urges Against Politicizing Montenegrin Army Victories

Montenegrin President Milatović has called for the glorious victories of the Montenegrin army not to be used for political infighting. He emphasized that these historical achievements belong to the nation and should not be exploited for partisan purposes.

Dino Merlin Holds Second Sold-Out Concert in Sarajevo
Cultureindex-hrjutarnji-listklix-ba+2n1-bihcdm-me15d ago5 sources

Dino Merlin Holds Second Sold-Out Concert in Sarajevo

Bosnian singer Dino Merlin successfully held his second sold-out concert at Koševo Stadium in Sarajevo, captivating the audience with his timeless hits. The event featured a special duet with Marko Louis, further electrifying the crowd.

Keiko Fujimori Sworn In as Peru's New President
WorldbloombergFTle-monde+19NPRAl Jazeerayle-uutisetruvtagesschauaftonbladetSCMPde-volkskrant+11 more19d ago22 sources

Keiko Fujimori Sworn In as Peru's New President

Keiko Fujimori has been inaugurated as the new president of Peru, following a narrow election victory. She takes office with a focus on combating crime and fostering national reconciliation.

Seattle Center Shooting Investigation Continues, Motive Explored
WorldBBCNYTle-monde+12cbcnosDWSCMPmorgunbladiddelfi-ltindex-hrYahoo+4 more20d ago15 sources

Seattle Center Shooting Investigation Continues, Motive Explored

Three people were killed in a shooting at a food festival near Seattle's Space Needle, with police identifying at least three shooters and arresting a 15-year-old suspect. Authorities are now investigating the motive, including potential gang ties, as new details emerge.

Pro-Kremlin Blogger Arrested After Criticizing Putin and Ukraine War
Worldaftonbladetirozhlasdie-presse+9delfi-ltdigi24hvgn1-serbiaaktuality-skhotnewscyprus-mailMoscow Times+1 more1mo ago12 sources

Pro-Kremlin Blogger Arrested After Criticizing Putin and Ukraine War

A formerly pro-Kremlin blogger, Ilya Remeslo, has been arrested for 'war fakes' months after denouncing Putin and criticizing the war in Ukraine. He faces two more months in pretrial detention after a previous psychiatric hospitalization.

Lana Del Rey Announces Two New Albums
Culturevgindex-hrn1-serbia+1klix-ba1mo ago4 sources

Lana Del Rey Announces Two New Albums

Lana Del Rey has announced plans to release two new albums, while also commenting on her marriage, describing it as more traditional than she initially thought.

Croatian Fugitive Dies After Robbery, Kidnapping, and Police Chase in Slovenia
Worlddeloindex-hrjutarnji-list+1n1-bih1mo ago4 sources

Croatian Fugitive Dies After Robbery, Kidnapping, and Police Chase in Slovenia

Srđan Aleksić, a former Croatian special forces member, died in Slovenia following a robbery and kidnapping in Croatia, a cross-border police chase, and a final confrontation where he allegedly stole an officer's weapon. Details emerged about the dramatic pursuit that ended with his death.

Tamara Kalinić's Lavish Lake Como Wedding Revealed
Cultureklix-ba1mo ago

Tamara Kalinić's Lavish Lake Como Wedding Revealed

Influencer Tamara Kalinić's luxurious wedding at Lake Como, Italy, has been revealed, with details emerging about its high cost, celebrity guests like Naomi Campbell, and the Bosnian photography duo behind the stunning images.

Hungarian Government Submits Bill to Oust President Amid Political Turmoil
Worldlsm-lvdanasklix-ba1mo ago3 sources

Hungarian Government Submits Bill to Oust President Amid Political Turmoil

The Hungarian government has submitted a constitutional bill to remove the president, while Viktor Orbán claims the current government is moving towards a dictatorship. This comes as Péter Magyar continues to challenge Orbán's administration, including by publishing a video of the former Hungarian president's villa.

Taylor Swift and Travis Kelce Marry in Star-Studded Madison Square Garden Ceremony
CultureBBCFTThe Guardian+51Al Jazeerayle-uutisetcnbcfazFrance 24telextvn24die-presse+43 more1mo ago54 sources

Taylor Swift and Travis Kelce Marry in Star-Studded Madison Square Garden Ceremony

Taylor Swift and Travis Kelce reportedly tied the knot in a secret ceremony at Madison Square Garden, officiated by Adam Sandler and featuring a performance by Stevie Nicks. The event saw a large guest list and details about Swift's Dior gown and the couple's intimate vows have emerged.

New Life on Brač Island
Culturedanas1mo ago

New Life on Brač Island

The articles discuss the concept of 'new life' on Brač island, suggesting a focus on revitalization or new beginnings in the area.

World Cup 2026 Group Stage Matches and Fan Engagement
WorldBBCNYTThe Guardian+64NPRAl JazeeraFox Newsnrkcnbchelsingin-sanomatfazabc-australia+56 more1mo ago67 sources

World Cup 2026 Group Stage Matches and Fan Engagement

The 2026 World Cup continued with various group stage matches, including France's victory over Norway and upcoming games like DR Congo vs. Uzbekistan and Egypt vs. Iran. Fan engagement was high, with promotions, live streams, and discussions around player injuries and team strategies.

Europe Grapples with Record-Breaking Heatwave, Multiple Deaths Reported
WorldBBCNYTle-monde+59The GuardiancbcruvtagesschaufazaftonbladetberlingskeDW+51 more1mo ago62 sources

Europe Grapples with Record-Breaking Heatwave, Multiple Deaths Reported

A severe heatwave is gripping large parts of Europe, bringing record-high temperatures, particularly in France where the average June temperature broke historical records. The extreme heat has led to at least 20 weather-linked deaths across France and Germany, with little relief expected soon.

Russian Warship Fires Warning Shots Near British Yacht in English Channel
WorldBBCThe GuardianAl Jazeera+32dr-dknostagesschaufazaftonbladetberlingskeFrance 24irozhlas+24 more2mo ago35 sources

Russian Warship Fires Warning Shots Near British Yacht in English Channel

A Russian warship reportedly fired warning shots near a British yacht in the English Channel, an incident described as 'scary' by the couple on board. The UK is investigating the event, which Prime Minister Rishi Sunak called 'extremely concerning'.

Investigation into Adriatic Maritime Accident and Safety Concerns
Worldindex-hr24ur2mo ago2 sources

Investigation into Adriatic Maritime Accident and Safety Concerns

Following a severe maritime accident between the islands of Šolta and Brač, experts are questioning the cause and whether it could have been avoided, citing long-standing concerns about poor oversight. Experienced captains are also highlighting increasing safety challenges in the Adriatic Sea.

Media Ethics and Public Shaming: When Individuals Become Targets
Opiniondelo2mo ago

Media Ethics and Public Shaming: When Individuals Become Targets

A Slovenian article explores the phenomenon of individuals becoming targets of public reckoning, often triggered by a single piece of media like a video or conversation snippet. It raises questions about the legitimacy of critical reporting in such contexts and the difficulty of stopping such mechanisms.

Anti-Immigrant Protests Erupt in Belfast After Knife Attack
WorldBBCbloombergFT+60le-mondeThe GuardianNPRAl JazeeraFox Newsnrkyle-uutisethelsingin-sanomat+52 more2mo ago63 sources

Anti-Immigrant Protests Erupt in Belfast After Knife Attack

Violent anti-immigrant protests erupted in Belfast, Northern Ireland, following a knife attack by a Sudanese man. Demonstrators set vehicles and buildings alight, leading to arrests and widespread unrest in the city.

Worldcdm-me2mo ago

Funeral Brawl in Mexico Over Deceased Man

A funeral in Mexico was disrupted by a brawl between women near the coffin, reportedly over the deceased man, turning the wake into a scene of disbelief that later went viral on social media.

Multiple Fatal and Serious Traffic Accidents Across Europe
Worldaftonbladetsvenska-dagbladetvg+5n1-serbiajutarnji-listluxemburger-wortn1-bihvijesti-me2mo ago8 sources

Multiple Fatal and Serious Traffic Accidents Across Europe

Several severe traffic accidents occurred across Europe, including a fatal bus-car collision in Sweden, a deadly incident in Remerschen, Luxembourg, and a fatal crash in Supetar, Croatia. Other incidents involved serious injuries to a child in Mostar and a man on a Serbian highway, highlighting a series of significant road incidents.

Vučić Reveals Gruesome Murder Details, Vows Crackdown
Worldindex-hrn1-serbiajutarnji-list+3danasklix-ban1-bih2mo ago6 sources

Vučić Reveals Gruesome Murder Details, Vows Crackdown

Serbian President Aleksandar Vučić has revealed horrific details about a murder in Belgrade, stating the victim's body was burned in a barrel and intended to be cemented. Vučić condemned the act as monstrous and vowed a strong response to the crime.