PERSPECTA

News from every angle

Results for "Rockstar"

200 stories found

Rockstar Releases Extended Gameplay Preview of Grand Theft Auto VI on Netflix
CultureBBChelsingin-sanomatnos+9sydney-morning-heraldvarietyiefimeridanewsbeastgulf-newsignenewsnme+1 more19m ago12 sources

Rockstar Releases Extended Gameplay Preview of Grand Theft Auto VI on Netflix

Rockstar Games unveiled a 27-minute extended look at Grand Theft Auto VI through a special broadcast on Netflix, showcasing new driving mechanics, environmental details, and soundtrack elements. The release marks the first official gameplay footage for the highly anticipated title following years of speculation.

Leaked GTA VI Footage Reveals Protagonist Lucia and Early Gameplay
Cultureignscreen-rant1d ago2 sources

Leaked GTA VI Footage Reveals Protagonist Lucia and Early Gameplay

Recently leaked gameplay footage from Grand Theft Auto VI offers the first detailed look at protagonist Lucia and suggests how the opening sequence may unfold. The clips have generated significant discussion among gaming communities ahead of the official release.

Take-Two Pursues Legal Action Against GTA 6 Leakers
Technologyder-standard3d ago

Take-Two Pursues Legal Action Against GTA 6 Leakers

Take-Two Interactive, parent company of Rockstar Games, has initiated legal proceedings against individuals responsible for leaking 'Grand Theft Auto 6' content. The company has requested information from Microsoft, Google, and other platforms to identify the leakers.

GTA VI Leaks Continue, Rockstar to Air Netflix Program
Technologybloomberghelsingin-sanomatla-vanguardia+1myjoyonline5d ago4 sources

GTA VI Leaks Continue, Rockstar to Air Netflix Program

Numerous videos of the highly anticipated game Grand Theft Auto VI have been leaked online, causing significant disruption and disappointment for developer Rockstar Games. The leaks have revealed early development footage, and Rockstar is also set to release a half-hour program on Netflix to showcase the game.

Take-Two confirms GTA 6 release date on track
Cultureign20d ago

Take-Two confirms GTA 6 release date on track

Rockstar owner Take-Two has confirmed that the November 19 release date for Grand Theft Auto VI is still on schedule, stating that an upcoming 'Extended Look' will boost consumer anticipation.

Grand Theft Auto VI Pre-Orders Set for June 25 Release
TechnologyBBCdr-dkyle-uutiset+22helsingin-sanomatruvfazle-figaroder-standardtelexvgmorgunbladid+14 more2mo ago25 sources

Grand Theft Auto VI Pre-Orders Set for June 25 Release

Pre-orders for Grand Theft Auto VI are scheduled to begin on June 25, ahead of its anticipated November launch, with fans eagerly awaiting the game. Take-Two shares have jumped following the announcement, and there is growing confidence that the game will not face further delays.

Red Dead Online Hosts 'The Naturalist' Event
Culturescreen-rant3mo ago

Red Dead Online Hosts 'The Naturalist' Event

Rockstar's Red Dead Online is hosting 'The Naturalist' event in May, offering players 4X RDO$ and XP for completing challenges, with a limited-time free download of Red Dead Redemption 2.

First Clayface Trailer Unveiled for James Gunn's DCU Body Horror Film
CultureAl Jazeerale-figaropublico+7varietyhollywood-reporterdanasdeadlinerolling-stoneignscreen-rant4mo ago10 sources

First Clayface Trailer Unveiled for James Gunn's DCU Body Horror Film

Warner Bros. has released the first trailer for the DCU's Clayface movie, teasing a grisly body horror film and confirming its R-rating. The trailer has generated significant discussion about the character's connection to James Gunn's DC Universe and the new Gotham City design.

Rockstar Games Suffers Hack and Data Leak
Cultureignscreen-rant4mo ago2 sources

Rockstar Games Suffers Hack and Data Leak

Rockstar Games has been targeted by a hack, leading to the exposure of GTA 5 data online and concerns about the PC release of GTA 6. The company is providing updates on the security breach.

Rockstar Unveils First GTA 6 Gameplay Trailer in Netflix Special
TechnologyThe Guardianyle-uutisetder-spiegel+10le-figarola-repubblicaorftelexvgel-mundoforbesindex-hr+2 more32m ago13 sources

Rockstar Unveils First GTA 6 Gameplay Trailer in Netflix Special

Rockstar Games has released the first official gameplay trailer for Grand Theft Auto VI through a dedicated Netflix special, revealing the game's setting, mechanics, and story elements. The broadcast drew unprecedented viewership, triggering temporary outages and traffic surges across streaming platforms including Twitch and Netflix.

Global Tributes Pour In Following Death of Country Music Legend Dolly Parton
CultureAPBBCNYT+64le-mondewapoThe GuardianNPRCNNFox Newsnzztimes-uk+56 more1d ago67 sources

Global Tributes Pour In Following Death of Country Music Legend Dolly Parton

Celebrities, world leaders, and fans worldwide have paid tribute to country music icon Dolly Parton following her passing. Her legacy of philanthropy, songwriting, and cultural impact continues to draw widespread admiration across multiple continents.

Global Tributes Pour In Following Death of Country Legend Dolly Parton
CultureAPBBCThe Guardian+70CNNFox Newsyle-uutisethelsingin-sanomatruvfazBarron'sberlingske+62 more1d ago73 sources

Global Tributes Pour In Following Death of Country Legend Dolly Parton

The country music icon Dolly Parton has died, prompting an outpouring of grief and tributes from fans, political figures, and fellow musicians worldwide who celebrate her enduring cultural impact and philanthropy.

NBA 2K27 Teases GTA 6 Collaboration Event
Cultureign2d ago

NBA 2K27 Teases GTA 6 Collaboration Event

NBA 2K27 is hinting at a Grand Theft Auto 6-themed event in collaboration with Rockstar Games. This comes as global release times for an extended look at GTA 6 have also been confirmed.

Peter Lynch's Stock-Picking Rules Revisited
BusinessYahoo3d ago

Peter Lynch's Stock-Picking Rules Revisited

The investment strategies of Fidelity's Magellan Fund manager Peter Lynch, who achieved an average annual return of 29% in the 1980s, are being re-examined for their potential relevance in today's market.

GTA 6 Leaker Continues to Release Footage
Technologyforbes5d ago

GTA 6 Leaker Continues to Release Footage

The individual responsible for leaking Grand Theft Auto 6 footage is reportedly continuing to release new content, including from a strip club, as Rockstar Games attempts to manage the situation.

Take-Two CEO Defends GTA 6 Digital-First Release and Pricing
Cultureforbeschannel-news-asiaign+1screen-rant20d ago4 sources

Take-Two CEO Defends GTA 6 Digital-First Release and Pricing

Take-Two CEO Strauss Zelnick defended the decision for a digital-first release of Grand Theft Auto 6, comparing physical releases to vinyl records, and stated that the game's pricing reflects inflation. He also noted unprecedented pre-orders while maintaining booking targets.

Gordon Ramsay Profiled in BBC Series
Culturedeadline1mo ago

Gordon Ramsay Profiled in BBC Series

Gordon Ramsay is set to be profiled in a new BBC landmark series titled 'The Rise of the Rockstar Chef,' produced by his Studio Ramsay Global outfit. He will be featured alongside Marco Pierre White and Heston Blumenthal.

Sony to End PlayStation Physical Game Production by 2028
CultureBBCThe Guardiandr-dk+33nrkyle-uutisetcnbchelsingin-sanomatnosfazberlingskeDW+25 more1mo ago36 sources

Sony to End PlayStation Physical Game Production by 2028

Sony has announced that it will cease the production of physical PlayStation game discs by 2028, transitioning entirely to digital downloads. This move signals the end of an era for physical media in PlayStation gaming.

GTA 6 Pre-Load Date, Price, and Pre-Order Bonuses Confirmed
Culturescreen-rant2mo ago

GTA 6 Pre-Load Date, Price, and Pre-Order Bonuses Confirmed

Rockstar Games has confirmed both the pre-load date for Grand Theft Auto 6 ahead of its November 19 release, and details regarding the game's price, Ultimate Edition, and pre-order bonuses, which will be available when pre-orders go live on June 25.

Pope Leo XIV Draws Over a Million to Madrid Mass and Calls for Compassion
WorldBBCle-mondewapo+53The GuardianNPRAl JazeeraFox Newsyle-uutisetcbccnbcruv+45 more2mo ago56 sources

Pope Leo XIV Draws Over a Million to Madrid Mass and Calls for Compassion

Pope Leo XIV concluded his visit to Madrid, drawing over a million people to an open-air Mass and a flower-carpeted procession. During his visit, the Pope called for compassion towards every human being and urged the world to be prepared for future challenges.

CultureDaily Star BD2mo ago

Report on 'Rockstar' Film

The Daily Star features a report or discussion about a film titled 'Rockstar,' likely covering its production, cast, or reception.

GTA 6 Release Timing and Marketing Plans Receive Official Update
Culturevarietyscreen-rant3mo ago2 sources

GTA 6 Release Timing and Marketing Plans Receive Official Update

Rockstar Games' parent company, Take-Two, has provided an official update on Grand Theft Auto 6, confirming its release timing and stating that marketing is on track to begin this summer. Gamers have largely praised the announced schedule for the highly anticipated title.

Celebrities Showcase Bold Fashion at Annual Met Gala
CultureAPReutersBBC+73wsjle-mondeThe GuardianNPRFox Newsnrkyle-uutisetcbc+65 more3mo ago76 sources

Celebrities Showcase Bold Fashion at Annual Met Gala

The annual Met Gala saw numerous celebrities showcasing a wide array of unique and often controversial fashion choices on the red carpet. Attendees' outfits, including Beyoncé's return and other notable looks, sparked widespread discussion and media coverage.

Rockstar Condemns Heartbreaking Grand Theft Auto VI Gameplay Leaks
CultureBBCFox Newsle-figaro+8vgel-mundoforbeshindustan-timesthe-journaligntempo-englishscreen-rant1d ago11 sources

Rockstar Condemns Heartbreaking Grand Theft Auto VI Gameplay Leaks

Rockstar Games has officially condemned recent unauthorized leaks of Grand Theft Auto VI gameplay footage and story spoilers, describing the breaches as heartbreaking for its development team. The studio warned players that the premature exposure could negatively impact the intended narrative experience upon the game's release.

Take-Two Subpoenas Microsoft and Discord in Hunt for GTA 6 Leaker
Cultureforbesvarietyign6d ago3 sources

Take-Two Subpoenas Microsoft and Discord in Hunt for GTA 6 Leaker

Take-Two Interactive, parent company of Rockstar Games, has issued subpoenas to Microsoft and Discord in its ongoing search for the individual responsible for leaking Grand Theft Auto VI footage. The company is seeking information to identify the leaker.

Waffle House Cook Fired After Viral Rap Song
CultureTimes of India7d ago

Waffle House Cook Fired After Viral Rap Song

Edric Riley, known as "Rockstar Riley," a Waffle House cook who went viral for his rap song "Waffy Options," claims he was fired weeks after his song praising the restaurant chain crossed 1 million TikTok views.

Opinion: GTA 6 should borrow from GTA 4
Cultureign12d ago

Opinion: GTA 6 should borrow from GTA 4

An IGN writer expresses hope that Rockstar Games will incorporate elements from Grand Theft Auto 4 into the upcoming Grand Theft Auto 6, based on a recent replay of the 2008 title.

Concerns Rise Over Potential GTA VI Delay
Technologyignzerohedge22d ago2 sources

Concerns Rise Over Potential GTA VI Delay

Fears of a potential delay for Grand Theft Auto VI have resurfaced after a former Rockstar developer stated he 'would not be shocked' if the game was postponed. This follows an actor's revelation of auditioning for 60 roles without hearing back from Rockstar.

Analyst Suggests GTA 6 Should Cost $200
Cultureign1mo ago

Analyst Suggests GTA 6 Should Cost $200

An analyst has suggested that Rockstar's upcoming Grand Theft Auto 6, priced at $80, is significantly undervalued and should cost $200, calling it 'The Last Great Game' before AI-driven development.

Concerns Over GTA 6's Impact on Gaming Industry
Culturescreen-rant2mo ago

Concerns Over GTA 6's Impact on Gaming Industry

Despite its unprecedented popularity, Grand Theft Auto 6 is reportedly setting a dangerous new precedent for the gaming industry, with even diehard fans expressing concern over Rockstar's choices.

Grand Theft Auto 6 Pre-Orders Go Live Ahead of November Release
TechnologyBBCyle-uutisetcbc+8tagesschauorfhvgindian-expressjerusalem-postndtvignscreen-rant2mo ago11 sources

Grand Theft Auto 6 Pre-Orders Go Live Ahead of November Release

Pre-orders for Grand Theft Auto 6 have officially launched, with the highly anticipated game set to be released on November 19. Gamers are reacting to the pricing and available editions, while some retailers are reportedly hesitant to stock the physical game.

Grand Theft Auto VI Pre-Orders Begin Amidst Price and Content Concerns
TechnologyBBCcnbcsvenska-dagbladet+20der-standardtelexvgforbeshvgindex-hrhotnewsTimes of India+12 more2mo ago23 sources

Grand Theft Auto VI Pre-Orders Begin Amidst Price and Content Concerns

Pre-orders for Grand Theft Auto VI have begun, with retailers and analysts discussing the game's $80-$100 price point and the lack of a physical disc. Fans have also expressed backlash over locked content and potential lore mistakes.

GTA VI Release Date Uncertainty Amidst Political Use of Imagery
WorldfazrzeczpospolitaTimes of India2mo ago3 sources

GTA VI Release Date Uncertainty Amidst Political Use of Imagery

There is ongoing confusion and speculation surrounding the release date of Grand Theft Auto VI, with the game's development posing challenges for other studios. This comes as Rockstar Games issued a two-word response after White House and Trump officials used GTA 6-style posters.

Take-Two Boss Comments on Failed GTA Competitors
Cultureign3mo ago

Take-Two Boss Comments on Failed GTA Competitors

Strauss Zelnick, CEO of Take-Two Interactive, discussed the challenges of creating successful video games, alluding to former Rockstar employees who attempted and failed to replicate Grand Theft Auto's success.

Rockstar Games Teases GTA 6 Release Date on Twitter
Cultureignscreen-rant3mo ago2 sources

Rockstar Games Teases GTA 6 Release Date on Twitter

Rockstar Games' official Twitter account posted a message suggesting that Grand Theft Auto 6 was released on May 26, leading to speculation and excitement among fans. This comes as Grand Theft Auto V and Grand Theft Auto Online are described as entering a new era.

Macron Criticizes Trump for Undermining NATO
WorldNYTwapoThe Guardian+57NPRFox Newsyle-uutisetcnbchelsingin-sanomatnosukrainska-pravdafaz+49 more4mo ago60 sources

Macron Criticizes Trump for Undermining NATO

French President Emmanuel Macron has criticized Donald Trump, advising him to speak less and avoid contradicting his own statements, asserting that Trump is undermining NATO.