PERSPECTA

News from every angle

Results for "MLA"

200 stories found

Youth Activism Awards Presented in Bosnia and Herzegovina
Cultureklix-ba3h ago

Youth Activism Awards Presented in Bosnia and Herzegovina

The Institute for Youth Development KULT awarded the "Youth Activism Award" to Mia Selena Lerch, Ana-Mirjana Simendić, Bilal Kovačević, Nadira Ćurulija, Enver Gluhić, and Adna Rizvan, recognizing them as the best activists across Bosnia and Herzegovina.

Youth Turn Away from Giorgia Meloni in Italy
Politicsvijesti-me8h ago

Youth Turn Away from Giorgia Meloni in Italy

A high turnout in a recent March referendum indicates that voters under 35 could play a decisive role in the 2027 elections, suggesting a growing disaffection among young people towards Giorgia Meloni.

Madrid Estimates 5,000 Migrants Remain in Ceuta
Worldirozhlasobservador20h ago2 sources

Madrid Estimates 5,000 Migrants Remain in Ceuta

Madrid estimates that approximately 5,000 migrants, including around 1,900 minors, remain in Ceuta. This situation continues to be a significant concern for Spanish authorities.

Former TMC MLA Nirmal Ghosh Arrested in RG Kar Rape-Murder Case
PoliticsTimes of Indiahindustan-timesindian-express+1ndtv23h ago4 sources

Former TMC MLA Nirmal Ghosh Arrested in RG Kar Rape-Murder Case

Former Trinamool Congress MLA Nirmal Ghosh was arrested in Odisha in connection with the RG Kar rape-murder case, two years after the incident. Ghosh is accused of playing a role in the hurried cremation of the victim, allegedly to cover up the crime.

Colombia Declares National Mourning as Search Continues for Earthquake Survivors
WorldBBCFTle-monde+57Al Jazeeranrkyle-uutisethelsingin-sanomatnosruvtagesschaufaz+49 more1d ago60 sources

Colombia Declares National Mourning as Search Continues for Earthquake Survivors

Colombia has declared three days of national mourning for the over 240 victims of a devastating earthquake, while rescue efforts continue to find more than 2,500 missing people. Miraculous rescues include a 32-year-old woman pulled alive after 36 hours and a two-month-old baby saved from the rubble.

57 Young People Killed on Serbian Roads This Year
Politicsdanas2d ago

57 Young People Killed on Serbian Roads This Year

The Serbian Road Traffic Safety Agency (ABS) reported that 57 young people aged 15 to 30 have died on Serbian roads since the beginning of the year until July, highlighting youth as a vulnerable group in traffic accidents.

Truck Crash in Egypt Kills 18, Including Child Laborers
WorldAl Jazeerayle-uutisetle-figaro+5index-hrjutarnji-listiefimeridan1-bihbalkan-web2d ago8 sources

Truck Crash in Egypt Kills 18, Including Child Laborers

A tragic truck crash in Egypt has resulted in the deaths of at least 18 people, many of whom were child laborers. The youngest victim was reportedly ten years old.

Delhi CM Criticizes AAP MLA for Inappropriate Attire in Viral Video
PoliticsTimes of Indiaindian-express2d ago2 sources

Delhi CM Criticizes AAP MLA for Inappropriate Attire in Viral Video

Delhi Chief Minister Arvind Kejriwal publicly criticized an Aam Aadmi Party (AAP) MLA for his inappropriate attire in a viral video, urging him to dress properly, especially when women are present for signatures. The CM's remarks highlighted concerns about decorum.

Solar Eclipse Sparks Scramble for Protective Glasses and Tourism Boom
ScienceBBCNYTFT+47The Guardianruvtagesschaufazaftonbladetberlingskele-figarolsm-lv+39 more3d ago50 sources

Solar Eclipse Sparks Scramble for Protective Glasses and Tourism Boom

A solar eclipse has led to a global scramble for protective viewing glasses, with stocks running low in many areas, and has also caused a significant surge in tourism to prime viewing locations. Concerns about public health and preparedness for safe viewing have also been raised.

Maldives Youth Fight Climate Change and Rising Sea Levels
Worldindex-hr4d ago

Maldives Youth Fight Climate Change and Rising Sea Levels

Young people in the Maldives are organizing protests and cleanup actions to combat climate change and excessive construction. They are striving to protect their islands, which are threatened by rising sea levels and could become uninhabitable within 50 years.

France Grapples with Severe Wildfire Season
World24ur4d ago

France Grapples with Severe Wildfire Season

France is experiencing one of its worst wildfire seasons in modern history, with over 120,000 hectares destroyed and 420 people, including 166 minors, arrested as the country prepares for a new heatwave.

Man Attacked with Knife in Osijek Park
Worldindex-hr5d ago

Man Attacked with Knife in Osijek Park

Police arrested a 25-year-old man suspected of attempting to murder a 62-year-old man with a sharp object in Osijek's King Držislav Park, leaving the victim seriously injured.

Children's Knight Games Held in Goražde
Worldklix-ba5d ago

Children's Knight Games Held in Goražde

The Children's Knight Games, a festival offering children the opportunity to socialize, play, and learn about medieval Bosnia, are being held in Omladinska Street in Goražde.

US Senate Passes Russia Sanctions Bill, Threatening Tariffs on India and China
WorldbloombergNYTwapo+52The GuardianNPRAl JazeeraFox Newsyle-uutisetcnbchelsingin-sanomattagesschau+44 more6d ago55 sources

US Senate Passes Russia Sanctions Bill, Threatening Tariffs on India and China

The US Senate has passed a bill imposing new sanctions on Russia, which includes a provision for 100% tariffs on India and China if they continue to purchase Russian oil. This move comes amid ongoing concerns about Russia's actions in Ukraine and potential threats to NATO allies.

Meta Fined $567 Million in New Mexico for Harming Young Users
Politicsirozhlasiefimerida6d ago2 sources

Meta Fined $567 Million in New Mexico for Harming Young Users

A court in New Mexico has ordered Meta to pay $567 million in fines for causing harm to young users, labeling the company's actions as a 'public nuisance.' The ruling suggests that Meta prioritized profits over the safety of its younger audience.

Heavy Rain and Mudslides Hit Western Austria
Worldtagesschau7d ago

Heavy Rain and Mudslides Hit Western Austria

Severe thunderstorms and heavy rainfall have caused mudslides and flooding in parts of western Austria, including popular tourist regions, with hikers evacuated in Bad Gastein.

Trump Renews Efforts to Limit Birthright Citizenship in US
WorldAPReutersBBC+99bloombergNYTeconomistwsjFTle-mondewapoThe Guardian+91 more7d ago102 sources

Trump Renews Efforts to Limit Birthright Citizenship in US

Donald Trump has signed new executive orders to again attempt to limit birthright citizenship in the United States, despite a previous Supreme Court decision blocking his first attempt. This move aims to curb what he refers to as 'birth tourism' and restrict citizenship for children born in the US to non-citizens.

French Ambassador to CAR Investigated Over Alleged Misconduct
WorldBBCThe Guardianhvg+1index-hr18h ago4 sources

French Ambassador to CAR Investigated Over Alleged Misconduct

The French ambassador to the Central African Republic is under investigation for alleged misconduct, including accusations of bringing dozens of young women to his official residence for sex parties. Disciplinary action is being considered against him.

Montenegro Youth Council Calls for Authentic Roma Representation in Parliament
Politicscdm-me22h ago

Montenegro Youth Council Calls for Authentic Roma Representation in Parliament

The Council of Youth Initiatives of the President of Montenegro has urged relevant institutions to prioritize authentic political representation for the Roma community. They called for concrete steps to ensure the Roma community gains its own representative in the Parliament of Montenegro as part of ongoing electoral reform.

Millions Across Europe Witness Partial Solar Eclipse
ScienceBBCNYTThe Guardian+60Al Jazeeranzzyle-uutisethelsingin-sanomatruvtagesschaufazaftonbladet+52 more1d ago63 sources

Millions Across Europe Witness Partial Solar Eclipse

Millions across Europe gathered to witness a partial solar eclipse, with many describing it as a unique and fascinating celestial event. Crowds flocked to viewing events, and special glasses quickly sold out as people observed the sun transition from bright daylight to partial darkness.

Putin Threatens Retaliation Over Western Seizure of Russian Assets
PoliticsbloombergwapoThe Guardian+58Al Jazeeraukrainska-pravdafazaftonbladetberlingskeder-spiegelDWle-figaro+50 more1d ago61 sources

Putin Threatens Retaliation Over Western Seizure of Russian Assets

Russian President Vladimir Putin has threatened to seize European ships globally if the EU confiscates Russian vessels, in retaliation for Western actions against Russian assets. This warning comes amidst ongoing tensions and concerns about the impact on international shipping.

Man Convicted in Fatal Bømlafjord Tunnel Car Crash
Worldberlingskevg2d ago2 sources

Man Convicted in Fatal Bømlafjord Tunnel Car Crash

A 37-year-old man has been convicted for a traffic accident in the Bømlafjord Tunnel that resulted in the death of his wife, Randi (79). The incident led to legal proceedings and a conviction.

Montenegrin NGO Warns Youth Exclusion Threatens Future
Politicsvijesti-me3d ago

Montenegrin NGO Warns Youth Exclusion Threatens Future

Milica Borozan, a project assistant at the CGO, stated that the NGO has consistently highlighted through research and direct work with young people that many do not see a future for themselves in Montenegro. She emphasized that youth cannot be the future if they are excluded from the present.

Young German Jews Consider Military Service
Cultureklix-ba3d ago

Young German Jews Consider Military Service

Eight decades after the Holocaust, a growing number of young Jews in Germany are openly supporting military service, with approximately 300 already serving, as the war in Ukraine shifts community attitudes towards the Bundeswehr.

Zelenskyy's Visit to Serbia Sparks Mixed Reactions and Media Scrutiny
Worldfazn1-serbiajutarnji-list+1danas3d ago4 sources

Zelenskyy's Visit to Serbia Sparks Mixed Reactions and Media Scrutiny

Ukrainian President Zelenskyy's visit to Serbia has drawn significant attention from German and Croatian media, with some praising it as a sign of political courage while others express disappointment and question Serbia's motives. Serbian politicians and analysts also offered varied opinions on the visit's outcomes for both leaders, with a Croatian journalist suggesting Serbia possesses resources Ukraine needs.

Trump's 'Low-Key' Approach to Iran Amid Gaza Plan Rejection
WorldBBCbloombergNYT+61FTwapoThe GuardianNPRAl Jazeeracnbcnosfaz+53 more3d ago64 sources

Trump's 'Low-Key' Approach to Iran Amid Gaza Plan Rejection

Former President Trump has adopted a 'low-key' approach to Iran talks, aiming to leverage the country's economic stress, while Israel's rejection of a Gaza plan raises concerns about prolonged conflict. Iran, in turn, has linked the reopening of the Strait of Hormuz to US concessions and ironically responded to Trump's 'chess game' analogy.

Balcony Collapse in Rijeka Injures Two Minors
Worldindex-hrjutarnji-list5d ago2 sources

Balcony Collapse in Rijeka Injures Two Minors

A balcony collapsed in the Pećine area of Rijeka, Croatia, injuring two minors who were on it at the time. Emergency services, including paramedics and firefighters, responded to the scene.

Culturecdm-me6d ago

Festival of Young Artists Begins in Ulcinj

The Festival of Young Artists commences tonight, August 8th, on Velika Plaža in Ulcinj, offering an all-night program of music, contemporary art, and ecology from 8 PM until sunrise.

Man Charged in 2005 Double Murder in Brattås, Norway
Worldaftonbladetsvenska-dagbladetvg+1trinidad-express7d ago4 sources

Man Charged in 2005 Double Murder in Brattås, Norway

A man has been charged in connection with a double murder that occurred in Brattås, Norway, 21 years ago in 2005. This development brings new attention to the long-unsolved case.

USKOK Indicts 26-Year-Old for Cocaine Smuggling via Bajakovo
Politicsindex-hr7d ago

USKOK Indicts 26-Year-Old for Cocaine Smuggling via Bajakovo

USKOK has filed an indictment before the County Court in Osijek against a 26-year-old man with dual Croatian and Serbian citizenship, accused of smuggling cocaine as part of a criminal organization. The charges relate to a significant drug trafficking operation.

Tokyo Ranked Best City for Generation Z
Worldvijesti-me7d ago

Tokyo Ranked Best City for Generation Z

Tokyo has been named the best city for Generation Z, according to a large annual survey of city residents worldwide. The ranking specifically highlighted responses from individuals under 30 years old.

Nicole Kidman Reflects on Marriage to Tom Cruise
Culturehotnewsklix-bavijesti-me+2balkan-webnewsbeast3h ago5 sources

Nicole Kidman Reflects on Marriage to Tom Cruise

Nicole Kidman spoke about her past marriage to Tom Cruise, describing herself as very young and madly in love at the time. She also touched upon her divorce from Keith Urban, noting it was not what she had envisioned for her life.

Nicole Kidman Reflects on Marriages to Tom Cruise and Keith Urban
CultureFox Newsvgindex-hr+9varietyiefimeridairish-independentklix-ba20-minutencdm-mebillboardtmz+1 more15h ago12 sources

Nicole Kidman Reflects on Marriages to Tom Cruise and Keith Urban

Nicole Kidman has opened up about her past marriages to Tom Cruise and Keith Urban, discussing the intense love she felt for Cruise and the vulnerability she experienced after her divorce from Urban. She also revealed that she would have given up her career for Cruise.

Body of Missing Portuguese Tourist Found Off Croatian Coast, Search Continues
Worldpublicodelfi-ltdelo+7index-hrn1-serbia24urjutarnji-listdanasklix-ban1-bih23h ago10 sources

Body of Missing Portuguese Tourist Found Off Croatian Coast, Search Continues

The body of one missing Portuguese tourist has been recovered near the Croatian island of Krk, while the search continues for another individual. Two other people who went missing in the Velebit Channel were rescued after spending hours in the sea.

Slovak government spending priorities questioned
Politicsaktuality-sk1d ago

Slovak government spending priorities questioned

An opinion piece criticizes the Slovak government's spending, highlighting a significant allocation of 50 million to a project named "Kaliňákovu Kukuricu" compared to only five million for youth work, arguing for better support for young people.

57 Young People Killed in Traffic Accidents in Serbia This Year
Worldn1-serbia2d ago

57 Young People Killed in Traffic Accidents in Serbia This Year

Serbia's Road Traffic Safety Agency (ABS) reported that 57 young people have died in traffic accidents across the country from the beginning of the year until July. The agency issued the warning on International Youth Day, highlighting the tragic toll on young lives.

Millions Across Europe Observe Rare Total Solar Eclipse
ScienceBBCbloombergNYT+60FTle-mondeThe Guardiannzzyle-uutisetcbcnosruv+52 more2d ago63 sources

Millions Across Europe Observe Rare Total Solar Eclipse

Millions of people across Europe gathered to witness a rare total solar eclipse, the first on mainland Europe since 2006, with many locations offering special viewing events and NASA observing from Spain. The event also raised concerns about potential strain on UK power supplies and a shortage of protective eyewear in some areas.

Why Young Slovenians Move Out Around Age 30
Culturedelo2d ago

Why Young Slovenians Move Out Around Age 30

An article explores the reasons why young Slovenians, on average, do not move out of their parental homes until around the age of 30, noting significant changes in life and the transition to adulthood in recent decades.

Guðjón Þorgils Composes Song for Pride Days
Cultureruv3d ago

Guðjón Þorgils Composes Song for Pride Days

Guðjón Þorgils, winner of a high school singing competition, has been offered to compose a song for this year's Hinsegin dagar (Pride Days) with Axel Ingi Árnason and Inga Auðbjörg Straumland.

Tallulah Willis Marries Justin Acee in Balenciaga Gown
Cultureindex-hr24uriefimerida+5klix-bacdm-menewsbeasttmzenews3d ago8 sources

Tallulah Willis Marries Justin Acee in Balenciaga Gown

Tallulah Willis, the youngest daughter of Bruce Willis and Demi Moore, has married Justin Acee. She wore a custom Balenciaga wedding gown that reportedly took 712 hours to create.

Montenegro's Foreign Policy Under Scrutiny Amid Divisions
Worldvijesti-me4d ago

Montenegro's Foreign Policy Under Scrutiny Amid Divisions

Mladen Grgić states that the first step towards improving relations with neighbors is for Montenegro to establish a coherent foreign policy, which is currently divided between official state policy and parallel party policies.

Boom Festival Launches 'Boomland Day' in September
Cultureobservador6d ago

Boom Festival Launches 'Boomland Day' in September

Boom Festival is introducing 'Dia da Boomland' on September 26th, an annual initiative with free admission. The Herdade da Granja will host nature trails, concerts, workshops, and Michelin-starred gastronomy.

Search Underway for Missing Minors in Slovenia and Romania
Worlddelo24urhotnews6d ago3 sources

Search Underway for Missing Minors in Slovenia and Romania

Authorities are conducting searches for missing minors, including a boy named Jon from Ljubljana, Slovenia, and an 11-year-old girl in Romania. Helicopters, drones, and tracking dogs are being utilized in the search efforts.

Man Attacked in Supetar Over Pentagram T-Shirt
Politicsindex-hr7d ago

Man Attacked in Supetar Over Pentagram T-Shirt

Police have released new details regarding an attack on an 18-year-old in Supetar, Brač, stating that the assailant was displeased with a pentagram motif on the victim's t-shirt and demanded he remove it.